Invitrogen™ Human TBPL1 (aa 2-83) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103755	100 μL

Catalog No. RP103755 Supplier Invitrogen™ Supplier No. RP103755

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84876. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that serves the same function as TBP and substitutes for TBP at some promoters that are not recognized by TFIID. It is essential for spermiogenesis and believed to be important in expression of developmentally regulated genes.

Specifications

• Accession Number: P62380
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9519
• Name: Human TBPL1 (aa 2-83) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 21 kDa TBP-like protein; 21-kDA TBP-like protein; 4732475G08; AW011832; AW491032; D18347; MGC:8389; MGC:9620; second TBP of unique DNA protein; STD; STUD; TATA box binding protein-like 1; TATA box binding protein-like protein; TATA box-binding protein related factor 2; TATA box-binding protein-like 1; TATA box-binding protein-like protein 1; TATA box-binding protein-like protein 1; TATA box-binding protein-like protein 1-like protein; TATA box-binding protein-related factor 2; TATA-box binding protein like 1; tbpl1; TBP-like 1; TBP-like factor; TBP-like protein; TBP-like protein 1; TBP-related factor 2; TBP-related protein; Tlf; TLP; Tlp21; trf; trf2; TRP; Unknown (protein for MGC:134257); zgc:92340
• Common Name: TBPL1
• Gene Symbol: TBPL1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining