Invitrogen™ Human TCEB2 (aa 15-95) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109055	100 μL

Catalog No. RP109055 Supplier Invitrogen™ Supplier No. RP109055

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).

Specifications

• Accession Number: Q15370
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6923
• Name: Human TCEB2 (aa 15-95) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610040H15Rik; 18 kDa, elongin B; cb162; ELOB; Elongin 18 kDa subunit; elongin B; elongin, 18-kD subunit; elongin-B; hypothetical protein LOC617277; RNA polymerase II transcription factor SIII p18 subunit; RNA polymerase II transcription factor SIII subunit B; SIII; SIII p18; TCEB 2; Tceb2; tceb2 protein; transcription elongation factor B (SIII) polypeptide 2 (18kD, elongin B); transcription elongation factor B (SIII), polypeptide 2; transcription elongation factor B (SIII), polypeptide 2 (18 kDa, elongin B); transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B); transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B); transcription elongation factor B polypeptide 2; transcription elongation factor B polypeptide 2; elongin-B; transcription elongation factor B subunit 2; wu:fb47e08
• Common Name: TCEB2
• Gene Symbol: ELOB
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining