Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human TCF2 (aa 23-132) Control Fragment Recombinant Protein

Catalog No. RP100696
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100696 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100696 Supplier Invitrogen™ Supplier No. RP100696
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hepatocyte Nuclear Factor 1 (HNF1, Homeoprotein LFB3, Transcription factor 2, TCF2, Variant hepatic nuclear factor) is a member of the homeodomain-containing superfamily of transcription factors. It is a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. HNF1has been shown to function in nephron development and regulates development of the embryonic pancreas. Mutations in the gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of the gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35680
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6928
Name Human TCF2 (aa 23-132) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias FJHN; Hepatocyte nuclear factor 1-beta; hepatocyte nuclear factor-1 beta; HNF1 beta A; HNF1 homeobox B; HNF1B; Hnf-1b; Hnf1beta; HNF-1Beta; HNF-1-beta; HNF2; homeoprotein LFB3; HPC11; LFB3; LF-B3; MODY5; Tcf2; Tcf-2; Transcription factor 2; Transcription factor 2 hepatic; Transcription factor 2 hepatic; LF-B3; variant hepatic nuclear factor; transcription factor 2, hepatic; Transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor; variant hepatic nuclear factor 1; vHNF1
Common Name TCF2
Gene Symbol HNF1B
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.