Invitrogen™ Human TCF7 (aa 385-438) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106897	100 μL

Catalog No. RP106897 Supplier Invitrogen™ Supplier No. RP106897

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCF7 (transcriptional factor 7) is a transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4+ and CD8+ immature thymocytes. Isoforms for TCF7 lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. TCF7 binds to the T-lymphocyte-specific enhancer element (5'-WWCAAAG-3') found in the promoter of the CD3E gene. It may also act as feedback transcriptional repressor of CTNNB1 and TCF7L2 target genes. TLE1, TLE2, TLE3, and TLE4 repress transactivation mediated by TCF7 and CTNNB1.

Specifications

• Accession Number: P36402
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6932
• Name: Human TCF7 (aa 385-438) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI465550; HMG-box; OTTHUMP00000159390; OTTHUMP00000159391; T cell factor-1; T-cell factor 1; T-cell specific; T-cell-specific transcription factor 1; Tcf1; TCF-1; Tcf7; TCF-7; Transcription factor 7; transcription factor 7 (T-cell specific, HMG-box); transcription factor 7, T cell specific; transcription factor 7, T-cell specific
• Common Name: TCF7
• Gene Symbol: TCF7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining