Invitrogen™ Human TdT (aa 356-440) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108819	100 μL

Catalog No. RP108819 Supplier Invitrogen™ Supplier No. RP108819

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Terminal Deoxynucleotidyl Transferase (TdT) is a DNA polymerase located in the cell nucleus which catalyses the polymerization of deoxynucleotides at the 3' hydroxyl ends of oligo or polydeoxynucleotide initiators and functions without a template. TdT is considered to be a highly specific marker for the diagnosis and classification of acute lymphoblastic lymphoma/leuksemias. The determination of TdT expression is most valuable when it is different to differentiate histologically between lymphoblastic lymphoma and Burkitt's lymphoma.

Specifications

• Accession Number: P04053
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1791
• Name: Human TdT (aa 356-440) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Deoxynucleotidyltransferase terminal; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; Dntt; Nucleosidetriphosphate DNA Deoxynucleotidylexotransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase; TDT; Terminal addition enzyme; terminal deoxynucleotidyl transferase; terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; terminal transferase
• Common Name: TdT
• Gene Symbol: DNTT
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSSWQEGKTWKAIRVDLVLCPYE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining