Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human TENM1 (aa 1518-1660) Control Fragment Recombinant Protein

Catalog No. RP92160
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92160 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92160 Supplier Invitrogen™ Supplier No. RP92160
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The teneurin transmembrane protein 1 (TENM1) is a member of a family of four neuronal cell surface proteins homologous to the Drosophila pair-rule gene Ten-m. TENM1 is expressed primarily in the developing central nervous system and may be proteolytically cleaved with the intracellular domain translocating to the nucleus. TENM1 is a direct target of the homeobox transcription factor EMX2, a transcription factor thought to be important for area specification in the developing cortex.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UKZ4
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10178
Name Human TENM1 (aa 1518-1660) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias IDten-1; odz (odd Oz/ten-m, Drosophila) homolog 3; odz, odd Oz/ten-m homolog 1; odz, odd Oz/ten-m homolog 1(Drosophila); Odz1; Odz2; ODZ3; Protein Odd Oz/ten-m homolog 1; RGD1561678; TCAP-1; TCPA-1; Ten-1; Ten-1 ECD; Ten-1 extracellular domain; Ten-1 intracellular domain; tenascin M1; tenascin-M1; teneurin 1; Teneurin C-terminal-associated peptide; Teneurin transmembrane protein 1; teneurin-1; TENM1; Ten-m1; TNM; TNM1
Common Name TENM1
Gene Symbol TENM1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IRTISRNQAHLNDMNIYEIASPADQELYQFTVNGTHLHTLNLITRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.