Invitrogen™ Human Tensin 3 (aa 647-731) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103240	100 μL

Catalog No. RP103240 Supplier Invitrogen™ Supplier No. RP103240

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63238. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Tensin (Tns) family of proteins is involved in the maintenance of cellular structure by anchoring actin filaments at the focal adhesion via F-actin binding and capping activities. Tns proteins also contain a Src homology 2 (SH2) domain and have the ability to be phosphorylated, suggesting a role in signal transduction cascades. These diverse characteristics indicate that Tns proteins may be important links between the cytoskeleton and signal transduction pathways. Tns3, also known as TEM6 or TENS1, localizes to the focal adhesions of the plasma membrane. It is predominantly expressed in thyroid and placenta but can also be found in heart, liver, brain, prostate, pancreas, kidney, lung, skeletal muscle and white blood cells. Tns3 is essential for proper growth and development, as suggested by growth retardation and death in a number of Tns3-/- mice.

Specifications

• Accession Number: Q68CZ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64759
• Name: Human Tensin 3 (aa 647-731) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC023928; F830010I22Rik; RGD1564174; TEM6; TENS1; TENS3; tensin 3; tensin3; tensin-3; tensin-3-like; tensin-like SH2 domain containing 1; tensin-like SH2 domain-containing 1; tensin-like SH2 domain-containing protein 1; thyroid specific PTB domain protein; TNS3; TPP; TSN3; tumor endothelial marker 6
• Common Name: Tensin 3
• Gene Symbol: Tns3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining