Invitrogen™ Human TESPA1 (aa 419-515) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106893	100 μL

Catalog No. RP106893 Supplier Invitrogen™ Supplier No. RP106893

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TESPA1 is a critical component of the TCR signalosome and is essential for T cell selection and maturation through the regulation of TCR signaling during T cell development. TESPA1 encodes a protein of 458 amino acids and is highly conserved among vertebrate species. TESPA1 expression was tightly regulated during T cell development, with highest expression at the DP stage. TESPA1 deficiency resulted in failure of positive selection and substantially fewer of CD4+ and CD8+ SP cells in the thymus.

Specifications

• Accession Number: A2RU30
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9840
• Name: Human TESPA1 (aa 419-515) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5830405N20Rik; A430001F24Rik; AI450549; HSPC257; KIAA0748; LOW QUALITY PROTEIN: protein TESPA1; protein TESPA1; TESPA1; thymocyte expressed; thymocyte expressed, positive selection associated 1; thymocyte-expressed positive selection-associated protein 1
• Common Name: TESPA1
• Gene Symbol: TESPA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNTETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQPQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining