Invitrogen™ Human TET1 (aa 435-578) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92566	100 μL

Catalog No. RP92566 Supplier Invitrogen™ Supplier No. RP92566

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dioxygenase that specifically binds methylcytosine (5mC), a minor base in mammalian DNA found in repetitive DNA elements that is crucial for retrotransposon silencing and mammalian development. Catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC). The clear function of 5-hydroxymethylcytosine (hmC) is still unclear but it may influence chromatin structure and recruit specific factors or may constitute an intermediate component in cytosine demethylation. 5-hydroxymethylcytosine (hmC) is present in ES cells and is enriched in the brain, especially in Purkinje neurons. May play a role in the fetal development of heart, lung and brain.

Specifications

• Accession Number: Q8NFU7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80312
• Name: Human TET1 (aa 435-578) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2510010B09Rik; AA517754; bA119F7.1; BB001228; CXXC finger 6; CXXC zinc finger 6; CXXC6; CXXC-type zinc finger protein 6; D10Ertd17e; KIAA1676; LCX; leukemia-associated protein with a CXXC domain; Methylcytosine dioxygenase TET1; mKIAA1676; MLL-TET1; RP11-119F7.1; Ten-eleven translocation 1 gene protein; ten-eleven translocation 1 gene protein homolog; ten-eleven translocation-1; tet methylcytosine dioxygenase 1; tet oncogene 1; Tet1; TET1 splice variant VP_DE4; TET1 splice variant VP_DE456; TET1-MLL
• Common Name: TET1
• Gene Symbol: TET1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining