Invitrogen™ Human TET3 (aa 1204-1322) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91314	100 μL

Catalog No. RP91314 Supplier Invitrogen™ Supplier No. RP91314

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62255. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TET3, a member of the ten-eleven-translocation (TET) family of genes, is a methylcytosine dioxygenase that catalyzes the conversion of methylcytosine to 5-hydroxymethylcytosine and is most abundantly expressed in hematopoietic cells. Unlike the related TET2 protein, mutations in TET3 have not been observed in any myeloid malignancies. TET3 has been shown to be involved in the demethylation of zygotic DNA before the first mitosis and has been suggested to be involved in the epigenetic reprogramming of the zygotic paternal DNA following natural fertilization and may also contribute to somatic cell nuclear reprogramming during animal cloning.

Specifications

• Accession Number: O43151
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 200424
• Name: Human TET3 (aa 1204-1322) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B430006D22Rik; BC037432; D230004J03Rik; hCG_40738; KIAA0401; Methylcytosine dioxygenase TET3; MGC22014; probable methylcytosine dioxygenase TET3; putative methylcytosine dioxygenase; Tet methylcytosine deoxygenase 3 isoform; tet methylcytosine dioxygenase 3; tet oncogene family member 3; Tet3
• Common Name: TET3
• Gene Symbol: TET3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining