Invitrogen™ Human TGF beta-3 (aa 84-166) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107257	100 μL

Catalog No. RP107257 Supplier Invitrogen™ Supplier No. RP107257

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transforming growth factor beta 3 (TGF beta 3) is the third member of the transforming growth factor family of cytokines, which also includes TGF beta 1 and beta 2. These cytokines are secreted in precursor form consisting of a bioactive C-terminal domain attached to an N-terminal domain known as latency associated protein (LAP). Cleavage of LAP results in the mature protein, which functions as a disulfide-linked homodimer. As with all members of the family, TGF beta 3 is highly conserved across species, with mouse and human TGF beta 3 demonstrating 100% sequence homology and cross-species activity.The members of this family can be expressed by most cell types and exert pleiotropic effects, which include the suppression of B- and T-cell effector activity, mediation of tissue healing, and suppression of tumor proliferation. The promotion of CD4+CD25+ T-cell expansion is a newly discovered function of the TGF beta cytokines, and indicates an important role in the protection against autoimmunity.

Specifications

• Accession Number: P10600
• Concentration: 3.20 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7043
• Name: Human TGF beta-3 (aa 84-166) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ARVD; ARVD1; FLJ16571; H-TGF-b-3; LAP; Latency-associated peptide; LDS5; prepro-transforming growth factor beta-3; RNHF; TGF beta 3; Tgfb3; TGF-B3; Tgfb-3; TGF-beta3; TGF-beta-3; Transforming growth factor; transforming growth factor beta 3; transforming growth factor beta precursor; transforming growth factor beta-3; Transforming growth factor beta-3 proprotein; transforming growth factor, beta 3; transforming growth factor-beta3
• Common Name: TGF beta-3
• Gene Symbol: TGFB3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining