Invitrogen™ Human THAP4 (aa 423-524) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99621	100 μL

Catalog No. RP99621 Supplier Invitrogen™ Supplier No. RP99621

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THAP4 gene ontology annotations related to this gene include DNA binding; DNA-binding transcription factor activity, RNA polymerase II-specific; heme binding; metal ion binding; protein homodimerization activity.

Specifications

• Accession Number: Q8WY91
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51078
• Name: Human THAP4 (aa 423-524) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2010320B01Rik; CGI-36; PP238; THAP domain containing 4; THAP domain-containing protein 4; Thap4
• Common Name: THAP4
• Gene Symbol: THAP4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining