Invitrogen™ Human THRAP3 (aa 798-928) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89453	100 μL

Catalog No. RP89453 Supplier Invitrogen™ Supplier No. RP89453

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52898. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THRAP3 is a 955 amino acid novel nuclear receptor and a member of the Thyroid hormone receptor associated proteins with a LISH domain and no obvious known sequence motifs. THRAP3 is a 150 kDa subunit of the large multiprotein complex TRAP and is important in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It is also known to play an important role in transcriptional coactivation. It is known to interact with DKC1, nop5/nap65 and fibrillarin. From the Northern blot analysis of several human tissues it was found that TRAP150 is ubiquitously expressed.

Specifications

• Accession Number: Q9Y2W1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9967
• Name: Human THRAP3 (aa 798-928) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9330151F09Rik; B230333E16Rik; BCLAF1 and THRAP3 family member 2; BCLAF2; THRAP3; thyroid hormone receptor associated protein 3; thyroid hormone receptor-associated protein 3; Thyroid hormone receptor-associated protein complex 150 kDa component; thyroid hormone receptor-associated protein, 150 kDa subunit; TRAP150
• Common Name: THRAP3
• Gene Symbol: THRAP3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETEEREESTTGFDKSRLGTKDFVGPSERGGGRARGTFQFRARGRGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRGRGAFPRGRGRFMFRKSSTSPKWAHDKFS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining