Invitrogen™ Human TID1 (aa 181-274) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98662	100 μL

Catalog No. RP98662 Supplier Invitrogen™ Supplier No. RP98662

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83522. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TID1 is a human homolog of the Drosophila tumor suppressor lethal (2) tumorous imaginal discs, l(2)tid and encodes two mitochondrial matrix localized splice variants of human Tid-1 designated hTid-1S and hTid-1L. These proteins are the conserved members of the DnaJ family of proteins which act as cochaperones for mitochondrial Hsp70. They contain a conserved tetrahedrical J domain which binds to Hsp70 chaperones and activates their ATPase activity. Expression of hTid-1L increases apoptosis induced by DNA damaging agents as mitomycin-C and TNF-a. A J-domain mutant of hTid-1L can dominantly suppress apoptosis and in sharp contrast the J-domain mutant of hTid-1S increases apoptosis. Expression of hTid-1S and hTid-1L affects cytochrome c release from the mitochondria and caspase 3 activation, while activation of caspase 8 is unaffected. It is strongly suggested that these two splice variants exert their anti- and pro- apoptotic effects through discrete substrates and activities. Hence the relative abundance of these proteins or their substrates may allow the mitochondria to dampen or enhance the apoptotic signals.

Specifications

• Accession Number: Q96EY1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9093
• Name: Human TID1 (aa 181-274) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200003J13Rik; 1810053A11Rik; C81173; DnaJ (Hsp40) homolog, subfamily A, member 3; DnaJ heat shock protein family (Hsp40) member A3; dnaJ homolog subfamily A member 3, mitochondrial; DnaJ protein Tid-1; Dnaja3; HCA57; Hepatocellular carcinoma-associated antigen 57; hTID-1; mTid-1; Tid1; Tid-1; Tid1l; Tumorous imaginal discs protein Tid56 homolog
• Common Name: TID1
• Gene Symbol: DNAJA3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining