Invitrogen™ Human TIMM10B (aa 8-103) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97328	100 μL

Catalog No. RP97328 Supplier Invitrogen™ Supplier No. RP97328

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62578. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.

Specifications

• Accession Number: Q9Y5J6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26515
• Name: Human TIMM10B (aa 8-103) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: fracture callus 1; fracture callus 1 homolog; fracture callus protein 1; fractured callus 1; fractured callus expressed transcript 1; FXC1; Mitochondrial import inner membrane translocase subunit Tim10 B; mitochondrial import inner membrane translocase subunit Tim9 B; small zinc finger-like protein; tim10b; Tim9b; TIMM10B; TIMM9B; translocase of inner mitochondrial membrane 10 homolog B (yeast); translocase of inner mitochondrial membrane 10B
• Common Name: TIMM10B
• Gene Symbol: Timm10b
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining