Invitrogen™ Human TIP47 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88959	100 μL

Catalog No. RP88959 Supplier Invitrogen™ Supplier No. RP88959

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82248. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIP47 has been described as cargo protein involved in the trafficking of the mannose-6-phosphate receptor between endosomes and the Golgi complex. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs and is required for endosome to Golgi transport. This protein also binds directly to the GTPase RAB9, a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. TIP47 has been localized in milk fat globule membranes of human and bovine origin. It has been described as a placental protein, as well. Increased amounts of TIP47 are secreted into circulation of cervix carcinoma patients. Therefore, this protein is probably significant as an oncodevelopmental marker.

Specifications

• Accession Number: O60664
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10226
• Name: Human TIP47 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1300012C15Rik; 47 kDa mannose 6-phosphate receptor-binding protein; 47 kDa MPR-binding protein; 47 kDa tail interaction protein; cargo selection protein TIP47; M6prbp1; mannose 6 phosphate receptor binding protein 1; mannose-6-phosphate receptor binding protein 1; mannose-6-phosphate receptor-binding protein 1; MGC11117; MGC2012; perilipin 3; perilipin-3; Placental protein 17; Plin3; PP17; tail-interacting protein, 47 kD; testicular tissue protein Li 114; TIP47; Unknown (protein for MGC:128897)
• Common Name: TIP47
• Gene Symbol: PLIN3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQVEDLQATFSSIHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining