Invitrogen™ Human TMEM119 (aa 117-167) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101538	100 μL

Catalog No. RP101538 Supplier Invitrogen™ Supplier No. RP101538

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62661. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tmem119 encodes a single-pass type I transmembrane protein which seems to interact with a multitude of micro-RNAs as well as certain transcription factors such as SMAD1, SMAD5 and RUNX2. Tmem119 has been identified as a surface marker of microglia that can be used to reliably distinguish microglia from infiltrating macrophages. Microglial cells are phagocytes that are restricted to the brain and involved in clearing up debris and dendrite pruning of neurons. They display a high functional plasticity, balancing neuroprotective and neurotoxic functions, which is reflected by their distinct physiology in response to changes in their microenvironment. Microglia are particularly mobile in areas of the brain undergoing restructuring. Reactive microglia co-express the marker Iba1. In a pathological context, microglia have been associated with differentiation of pathogenic/inflammatory A1 type astrocytes by secretion of Cq1, IL-1a and TNF when stimulated with LPS, and thought to contribute to the pathology of several neurodegenerative diseases such as Alzheimers, Parkinsons, Chorea Huntingtons disease and Multiple Sclerosis. The specific function Tmem119 plays on microglial cells remains unclear. Outside of the neural system, Tmem119 seems to be involved in osteoblast differentiation/ossification.

Specifications

• Accession Number: Q4V9L6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 338773
• Name: Human TMEM119 (aa 117-167) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW208946; BC025600; OBIF; Osteoblast induction factor; PSEC0199; Tmem119; Transmembrane protein 119; UNQ731/PRO1415
• Common Name: TMEM119
• Gene Symbol: TMEM119
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining