Invitrogen™ Human TMEM123 (aa 36-93) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108478	100 μL

Catalog No. RP108478 Supplier Invitrogen™ Supplier No. RP108478

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111556. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transmembrane protein 123, or Tmem123, is a single-pass type I membrane protein and belongs to the CD164 family. Tmem123 acts as a novel marker for DC maturation. DCs are also known as professional antigen-presenting cells. It is reported that the Tmem123 molecule may be closely associated with the cell surface expression of CD40. It was also reported previously that Tmem123 protein may also be responsible for oncotic cell death, which is characterized by cell swelling, organelle swelling, vacuolization, increased membrane permeability and cell adhesion.

Specifications

• Accession Number: Q8N131
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 114908
• Name: Human TMEM123 (aa 36-93) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310075C12Rik; KCT3; KCT-3; keratinocytes associated transmembrane protein 3; keratinocytes-associated transmembrane protein 3; Porimin; PORMIN; pro oncosis receptor inducing membrane injury; pro-oncosis receptor inducing membrane injury; PSEC0111; RGD1305625; serine/threonine-rich receptor; TMEM123; Transmembrane protein 123; UNQ641/PRO1271
• Common Name: TMEM123
• Gene Symbol: TMEM123
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining