Invitrogen™ Human TMEM63B (aa 303-387) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94862	100 μL

Catalog No. RP94862 Supplier Invitrogen™ Supplier No. RP94862

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56095. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.

Specifications

• Accession Number: Q5T3F8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55362
• Name: Human TMEM63B (aa 303-387) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC026370; C6orf110; CSC1-like protein 2; RGD1305862; RP3-421H19.2; Tmem63b; Tmem63b-ps1; Transmembrane protein 63B; transmembrane protein 63B, pseudogene 1; transmembrane protein 63B; CSC1-like protein 2
• Common Name: TMEM63B
• Gene Symbol: TMEM63B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKENVPTMINPKPCGHLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining