Invitrogen™ Human TMX4 (aa 9-119) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93684	100 μL

Catalog No. RP93684 Supplier Invitrogen™ Supplier No. RP93684

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51380. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and C-terminal ASP/GLU-rich calcium binding domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The encoded protein has been shown to have reductase activity in vitro.

Specifications

• Accession Number: Q9H1E5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56255
• Name: Human TMX4 (aa 9-119) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810417D04Rik; 4930500L08Rik; AI843224; AW046784; D2Bwg1356e; DJ971N18.2; Kiaa1162; mKIAA1162; PDIA14; protein disulfide isomerase family A, member 14; PSEC0095; RGD1305146; thioredoxin domain containing 13; thioredoxin domain-containing protein 13; thioredoxin related transmembrane protein 4; thioredoxin-related transmembrane protein 4; Tmx4; Txndc13; UNQ475/PRO938
• Common Name: TMX4
• Gene Symbol: TMX4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining