Invitrogen™ Human TNFAIP2 (aa 342-460) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105835	100 μL

Catalog No. RP105835 Supplier Invitrogen™ Supplier No. RP105835

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNFAIP2, also known as B94, is a TNF-a-regulated gene that is expressed in endothelial cells, peripheral blood cells, and mature sperm. Recently, elevated TNFAIP2 expression was observed in nasopharyngeal carcinoma, and high expression of TNFAIP2 was significantly correlated with higher levels of cell migration, invasion and metastasis, suggesting that TNFAIP2 may serve as a useful prognostic indicator for nasopharyngeal carcinoma. TNFAIP2 has also been implicated as part of the viral-sensing circuit of the innate immune response.

Specifications

• Accession Number: Q03169
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7127
• Name: Human TNFAIP2 (aa 342-460) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B94; Exoc3l3; exocyst complex component 3-like 3; M-sec; primary response gene B94 protein; TNF alpha induced protein 2; TNF alpha-induced protein 2; TNF alpha-IP 2; Tnfaip2; tnfb94; Tnfip2; tumor necrosis factor alpha-induced protein 2; tumor necrosis factor induced protein 2; tumor necrosis factor, alpha induced protein 2; tumor necrosis factor, alpha-induced protein 2
• Common Name: TNFAIP2
• Gene Symbol: TNFAIP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RWAEDVPPQRLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRANVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining