Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human TNIK (aa 808-933) Control Fragment Recombinant Protein

Catalog No. RP89796
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89796 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89796 Supplier Invitrogen™ Supplier No. RP89796
Only null left
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNIK or TRAF2 and NCK interacting kinase is characterized by an N-terminal kinase domain and a C-terminal GCK domain that serves a regulatory function. TNIK is mainly expression in brain, heart, and spleen and it is a specific effector of RAP2 which regulate actin cytoskeleton. TNIK is autophosphorylated in a manner dependent upon lys54 in the ATP-binding pocket of its kinase domain and plays a main role in cytoskeleton regulation. TNIK has also been shown to phosphorylate gelsolin, the principal intracellular and extracellular actin-severing protein, in vitro. This and evidence from mutational studies suggest that TNIK functions in the regulation of the cytoskeleton.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UKE5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23043
Name Human TNIK (aa 808-933) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500031A17Rik; 4831440I19Rik; AI451411; C530008O15Rik; C630040K21Rik; KIAA0551; RGD1561817; Tnik; TRAF2 and NCK interacting kinase; TRAF2 and NCK-interacting protein kinase
Common Name TNIK
Gene Symbol TNIK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.