Invitrogen™ Human TOLLIP (aa 147-236) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97260	100 μL

Catalog No. RP97260 Supplier Invitrogen™ Supplier No. RP97260

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83431. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Toll-like receptors (TLRs) are evolutionarily conserved pattern-recognition molecules resembling the toll proteins that mediate antimicrobial responses in Drosophila. These proteins recognize different microbial products during infection and serve as an important link between the innate and adaptive immune responses. The TLRs act through adaptor molecules to activate various kinases and transcription factors so the organism can respond to potential infection. These adaptor molecules include TOLLIP, MyD88, and TRIF. TOLLIP associates directly with TLR2 and TLR 4, acting as an inhibitor to TLR activation. This negative regulation of TLR signaling may serve to limit the production of proinflammatory mediators during infection and inflammation.

Specifications

• Accession Number: Q9H0E2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54472
• Name: Human TOLLIP (aa 147-236) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4930403G24Rik; 4931428G15Rik; adapter protein; EMBL:AAI33068.1}; FLJ33531; IL-1RAcPIP; toll interacting protein; toll-interacting protein; TOLLIP; tollip {ECO:0000312
• Common Name: TOLLIP
• Gene Symbol: TOLLIP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining