Invitrogen™ Human TOMM22 (aa 1-76) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91498	100 μL

Catalog No. RP91498 Supplier Invitrogen™ Supplier No. RP91498

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51804. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tom22 has a negatively charged N-terminal region exposed to the cytosol, a putative transmembrane region, and a C-terminal intermembrane space region with little negative charge. The following functions can be assigned to the three domains of Tom22: the cytosolic N-terminal domain plays a dual role, specifically important for presequence binding; the intermembrane space domain provides a trans binding site for presequences, and the single membrane anchor of Tom22 is crucial for the integrity of the GIP (general import gene) complex. The TOM complex of mammalian mitochondria resembles the fungal Tom complex, but is distinct from the plant TOM system. Thus, while unique components of the mammalian mitochondrial import system have been identified (e. g. TOM34 and metaxin), Tom22, and Tom37 have not been identified in plant mitochondria.

Specifications

• Accession Number: Q9NS69
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56993
• Name: Human TOMM22 (aa 1-76) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1C9-2; 2310047D01; hTom22; Mitochondrial import receptor subunit TOM22 homolog; mitochondrial import receptor Tom22; MST065; MSTP065; rTOM22; Tom22; Tomm22; Translocase of outer membrane 22 kDa subunit homolog; translocase of outer mitochondrial membrane 22; translocase of outer mitochondrial membrane 22 homolog; translocase of outer mitochondrial membrane 22 homolog (yeast)
• Common Name: TOMM22
• Gene Symbol: Tomm22
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining