Invitrogen™ Human TPT1 (aa 1-96) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102871	100 μL

Catalog No. RP102871 Supplier Invitrogen™ Supplier No. RP102871

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TPT1 (translationally controlled tumor protein 1) is a 23 kDa member of the TCTP family of calcium binding proteins. TPT1 is localized in the cytoplasm and widely expressed and serves as a transcriptional activator, calcium transporter, histamine inducer and antiapoptotic caspase 3 inhibitor. TPT1 is a cytokine-like molecule that causes the release of histamine, IL-4 and IL-13 from basophils as well as the secretion of IL-8 and a calcium response in eosinophils. TPT1 plays a pivotal role in allergic diseases and due to its wide distribution in brain, is thought to be involved in neurodegenerative disorders, such as Alzheimer's disease and Down syndrome.

Specifications

• Accession Number: P13693
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7178
• Name: Human TPT1 (aa 1-96) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 21 kDa polypeptide; 21 kDa polypeptide under translational control; fortilin; Histamine-releasing factor; HRF; Lens epithelial protein; p02; p21; p23; TCTP; Tpt1; translationally regulated transcript (21 kDa); translationally-controlled tumor protein; Trt; tumor protein, translationally-controlled 1
• Common Name: TPT1
• Gene Symbol: TPT1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining