Invitrogen™ Human TR2 (aa 43-109) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105437	100 μL

Catalog No. RP105437 Supplier Invitrogen™ Supplier No. RP105437

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined.

Specifications

• Accession Number: P13056
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7181
• Name: Human TR2 (aa 43-109) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4831444H07Rik; 80.3; 80-3 cNDA; ATAR; CD270; CD40-like protein; early embryonic nuclear receptor; Eenr; herpes virus entry mediator A; Herpesvirus entry mediator A; HVEA; HVEM; LIGHTR; mTR2; nr2c1; Nuclear receptor subfamily 2 group C member 1; nuclear receptor subfamily 2, group C isoform; nuclear receptor subfamily 2, group C, member 1; nuclear receptor subfamily 2, group H, member 1; orphan nuclear receptor TR2; orphan receptor, TR2-11; pregnancy specific beta-1-glycoprotein 4; Psg4; testicular receptor 2; TNF receptor superfamily member 14; TNFRSF14; Tr2; TR2 nuclear hormone receptor; Tr2-11; Tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); Tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; UNQ329/PRO509
• Common Name: TR2
• Gene Symbol: Nr2c1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining