Invitrogen™ Human TRAF3 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89047	100 μL

Catalog No. RP89047 Supplier Invitrogen™ Supplier No. RP89047

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tumor necrosis factor (TNF) induced signaling is mediated through association of TNF receptor (TNFR) with adaptor proteins, such as TNF receptor associated proteins (TRAFs). TRAFs form a family of cytoplasmic adapter proteins that mediate signal transduction from many members of the TNF-receptor superfamily (e. g. RANK, CD30, CD40, etc. ) and the interleukin-1 receptor. The carboxy-terminal region of TRAFs is required for self-association and interaction with receptor cytoplasmic domains following ligand-induced oligomerization. Recent molecular cloning studies have lead to identification of six TRAFs (TRAF1-TRAF6). TRAF3, originally named CRAF1, interacts directly with the CD40 cytoplasmic tail through a region of similarity to the tumor necrosis factor-alpha (TNF-alpha) receptor-associated factors. TRAF3 binds only a single site, which contains the sequence PEQET, whereas TRAF1 and TRAF2 are capable of binding to either the PEQET site or an additional downstream domain.

Specifications

• Accession Number: Q13114
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7187
• Name: Human TRAF3 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI528849; amn; CAP1; CAP-1; CD40 associated protein 1; CD40 binding protein; CD40 receptor associated factor 1; CD40 receptor-associated factor 1; CD40-binding protein; CD40BP; CRAF1; IIAE5; LAP1; LMP1-associated protein 1; RING-type E3 ubiquitin transferase TRAF3; T-BAM; TNF receptor associated factor 3; Tnf receptor-associated factor 3; TRAF3; Trafamn
• Common Name: TRAF3
• Gene Symbol: TRAF3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining