Invitrogen™ Human TRAF6 (aa 289-373) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92877	100 μL

Catalog No. RP92877 Supplier Invitrogen™ Supplier No. RP92877

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tumor necrosis factor (TNF) receptor associated factors (TRAFs) were initially discovered as adaptor proteins that link the TNF receptor superfamily to signaling pathways and are thus important regulators of cell death and cellular response to stress. TRAF proteins share a homology region that allows them to bind to cell receptors and other TRAF proteins, causing the activation of different signal cascades depending on the TRAFs involved. For example, TRAF2 and TRAF3 directly bind to the CD40, a NF receptor superfamily member involved in inducing B cell immunity, and are critical for NF-kappa-B activation in mouse B lymphocytes. TRAF2 along with TRAF6 has also been shown to be required for CD40 signaling in nonhemopoietic cells. TRAF2 also interacts with the TRFR superfamily member lymphotoxin-beta receptor (LTbetaR) in association with TRAF3 and the apoptosis inhibitors cIAP1 and Smac.

Specifications

• Accession Number: Q9Y4K3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7189
• Name: Human TRAF6 (aa 289-373) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310003F17Rik; AI851288; C630032O20Rik; E3 ubiquitin-protein ligase TRAF6; interleukin-1 signal transducer; MGC:3310; RING finger protein 85; RING-type E3 ubiquitin transferase TRAF6; RNF85; TNF receptor associated factor 6; TNF receptor-associated factor 6; TNF receptor-associated factor 6, E3 ubiquitin protein ligase; Traf6
• Common Name: TRAF6
• Gene Symbol: TRAF6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining