Invitrogen™ Human TRAP220 (aa 44-136) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106418	100 μL

Catalog No. RP106418 Supplier Invitrogen™ Supplier No. RP106418

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Specifications

• Accession Number: Q15648
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5469
• Name: Human TRAP220 (aa 44-136) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Activator-recruited cofactor 205 kDa component; AI480703; ARC205; CRSP1; CRSP200; CRSP210; DRIP205; DRIP230; l11Jus15; MED1; Mediator complex subunit 1; mediator of RNA polymerase II transcription subunit 1; p53 regulatory protein RB18A; Pbp; peroxisome proliferator activated receptor binding protein; peroxisome proliferator-activated receptor-binding protein; Ppar binding protein; PPAR-binding protein; PPARBP; PPARG binding protein; PPARGBP; PPRB; RB18A; RGD1559552; Thyroid hormone receptor-associated protein complex 220 kDa component; thyroid hormone receptor-associated protein complex component TRAP220; thyroid receptor interacting protein 2; thyroid receptor-interacting protein 2; TRAP220; TR-interacting protein 2; TRIP2; TRIP-2; vitamin D receptor-interacting protein 230 kD; vitamin D receptor-interacting protein complex component DRIP205
• Common Name: TRAP220
• Gene Symbol: MED1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining