Invitrogen™ Human TRAPPC10 (aa 838-968) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104221	100 μL

Catalog No. RP104221 Supplier Invitrogen™ Supplier No. RP104221

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRAPPC10, also known as TMEM1 (transmembrane protein 1), EHOC1 (epilepsy holoprosencephaly candidate 1 protein) or GT334, is a widely expressed 1,259 amino acid protein that may function in vesicular transport. Despite its name, TRAPPC10 does not contain transmembrane domains. It is the human ortholog of the yeast Trs130 protein and its structure and function appears to be conserved. Localizing to the cis-Golgi apparatus, TRAPPC10 is believed to be involved in transport from the endoplasmic reticulum (ER) to the Golgi functioning as a component of the multisubunit transport protein particle (TRAPP) complex. Mutations in the gene encoding TRAPPC10 may be involved in autoimmune polyglandular disease type 1 or Unverricht-Lundborg disease, an autosomal recessive type of progressive myoclonic epilepsy.

Specifications

• Accession Number: P48553
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7109
• Name: Human TRAPPC10 (aa 838-968) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B230307C21Rik; EHOC1; EHOC-1; epilepsy holoprosencephaly candidate 1 protein; epilepsy holoprosencephaly candidate-1 protein; Gm870; GT334; Protein GT334; TMEM1; trafficking protein particle complex 10; trafficking protein particle complex subunit 10; trafficking protein particle complex subunit 10; LOW QUALITY PROTEIN: trafficking protein particle complex subunit 10; trafficking protein particle complex subunit 130; trafficking protein particle complex subunit TMEM1; transmembrane protein 1; transport protein particle subunit TMEM1; TRAPP 130 kDa subunit; TRAPP subunit TMEM1; trappc10; TRS130; TRS30; wu:fc21a02
• Common Name: TRAPPC10
• Gene Symbol: TRAPPC10
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RAVVYSNTREQSSEAALRIQSSDKVTSISLPVAPAYHVIEFELEVLSLPSAPALGGESDMLGMAEPHRKHKDKQRTGRCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTTHSLLSSGTRKYVQVCVQNLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining