Invitrogen™ Human TRIM2 (aa 343-430) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96625	100 μL

Catalog No. RP96625 Supplier Invitrogen™ Supplier No. RP96625

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57430 (PA5-57430. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic filaments. Its function has not been identified.

Specifications

• Accession Number: Q9C040
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23321
• Name: Human TRIM2 (aa 343-430) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CMT2R; E3 ubiquitin-protein ligase TRIM2; KIAA0517; mKIAA0517; narf; Neural activity-related RING finger protein; RING finger protein 86; RING-type E3 ubiquitin transferase TRIM2; RNF86; TRIM2; tripartite motif containing 2; tripartite motif protein 2; tripartite motif protein TRIM2; tripartite motif-containing 2; tripartite motif-containing protein 2
• Common Name: TRIM2
• Gene Symbol: Trim2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining