Invitrogen™ Human TRIM46 (aa 492-594) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108210	100 μL

Catalog No. RP108210 Supplier Invitrogen™ Supplier No. RP108210

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84260. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Microtubule-associated protein that is involved in the formation of parallel microtubule bundles linked by cross-bridges in the proximal axon. Required for the uniform orientation and maintenance of the parallel microtubule fascicles, which are important for efficient cargo delivery and trafficking in axons. Thereby also required for proper axon specification, the establishment of neuronal polarity and proper neuronal migration. [UniProt].

Specifications

• Accession Number: Q7Z4K8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80128
• Name: Human TRIM46 (aa 492-594) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Gene Y protein; geneY; TRIFIC; TRIM46; tripartite motif containing 46; tripartite motif protein 46; tripartite motif-containing 46; tripartite motif-containing protein 46; tripartite, fibronectin type III and C-terminal SPRY motif-containing; tripartite, fibronectin type-III and C-terminal SPRY motif protein
• Common Name: TRIM46
• Gene Symbol: TRIM46
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining