Invitrogen™ Human TRMT61A Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108751	100 μL

Catalog No. RP108751 Supplier Invitrogen™ Supplier No. RP108751

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139776. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalytic subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA (PubMed:16043508). Catalytic subunit of mRNA N(1)-methyltransferase complex, which mediates methylation of adenosine residues at the N(1) position of a small subset of mRNAs: N(1) methylation takes place in tRNA T-loop-like structures of mRNAs and is only present at low stoichiometries (PubMed:29107537, PubMed:29072297). [UniProt].

Specifications

• Accession Number: Q96FX7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 115708
• Name: Human TRMT61A Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6720458F09Rik; AI606093; C14orf172; GCD14; GCD14 and PCMT domain containing protein RGD1359191; GCD14/PCMT domain containing protein RGD1359191; Gcd14p; hTRM61; mRNA methyladenosine-N(1)-methyltransferase catalytic subunit TRMT61A; RGD1359191; TRM61; Trmt61a; tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A; tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61; tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A; tRNA methyltransferase 61 homolog A; tRNA methyltransferase 61A; tRNA(m1A58)-methyltransferase subunit TRM61; tRNA(m1A58)-methyltransferase subunit TRMT61A; tRNA(m1A58)MTase subunit TRM61; tRNA(m1A58)MTase subunit TRMT61A
• Common Name: TRMT61A
• Gene Symbol: TRMT61A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFPDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining