Invitrogen™ Human TRPM2 (aa 302-429) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103848	100 μL

Catalog No. RP103848 Supplier Invitrogen™ Supplier No. RP103848

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111058. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRPM2 belongs to the ion transport protein family which includes Sodium, Potassium, Calcium ion channels. This family is characterized by proteins possessing 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. TRPM2 is activated by oxidative stress and confers susceptibility to cell death. Further, TRPM2 is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. Several alternatively spliced transcript variants of the TRPM2 gene have been described, but their full-length nature is not known.

Specifications

• Accession Number: O94759
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7226
• Name: Human TRPM2 (aa 302-429) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9830168K16Rik; C79133; EC 3.6.1.13; EREG 1; EREG1; Estrogen-responsive element-associated gene 1 protein; KNP 3; KNP3; Long transient receptor potential channel 2; LTRPC 2; LTRPC2; LTrpC-2; MGC133383; NUDT9H; NUDT9L1; null; transient receptor potential cation channel subfamily M member 2; transient receptor potential cation channel, subfamily M, member 2; transient receptor potential channel 7; Transient receptor potential melastatin 2; transient receptor potential melastatin family 2; transient receptor protein 7; Trp7; TRPC 7; TRPC7; TRPM 2; Trpm2; Trpm2-predicted; Trrp7
• Common Name: TRPM2
• Gene Symbol: TRPM2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining