Invitrogen™ Human TRPV3 (aa 702-789) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107697	100 μL

Catalog No. RP107697 Supplier Invitrogen™ Supplier No. RP107697

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111648. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRPV3 belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member (TRPV1) gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels.

Specifications

• Accession Number: Q8NET8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 162514
• Name: Human TRPV3 (aa 702-789) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110036I10Rik; AI644701; FNEPPK2; heat sensitive channel TRPV3; MGC124324; MGC124325; Nh; non-hair; OLMS; Transient receptor potential cation channel subfamily V member 3; transient receptor potential cation channel, subfamily V, member 3; TRP ion channel TRPV3; TrpV3; Vanilloid receptor-like 3; vanilloid receptor-related osmotically activated channel protein; VRL 3; VRL3; VRL-3
• Common Name: TRPV3
• Gene Symbol: TRPV3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining