Invitrogen™ Human TSC2 (aa 318-405) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95482	100 μL

Catalog No. RP95482 Supplier Invitrogen™ Supplier No. RP95482

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSC2 (Tuberin, Tuberous sclerosis complex, TSC Complex Subunit 2), is implicated as a tumor suppressor and may function in vesicular transport, play a role in the regulation of cell growth arrest and in the regulation of transcription mediated by steroid receptors. TSC2 associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Phosphorylation of tuberin on Ser 939 and Thr 1462 regulates its interaction with hamartin, and is stimulated by various growth factors through the phosphoinositide 3-kinase/Akt pathway. TSC2 may have a function in vesicular transport, but may also play a role in the regulation of cell growth arrest and in the regulation of transcription mediated by steroid receptors. Interaction between TSC1 and TSC2 may facilitate vesicular docking. TSC2 specifically stimulates the intrinsic GTPase activity of the Ras related protein RAP1A and RAB5, suggesting a possible mechanism for its role in regulating cellular growth. Mutations in TSC2 lead to constitutive activation of RAP1A in tumors and are involved in diseases such as lymphangioleiomyomatosis and TSC2 angiomyolipoma. Alternative splicing results in transcript variants of three different isoforms of TSC2.

Specifications

• Accession Number: P49815
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7249
• Name: Human TSC2 (aa 318-405) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: LAM; Nafld; OTTHUMP00000198394; PPP1R160; protein phosphatase 1, regulatory subunit 160; Rc; renal carcinoma; Tcs2; Tsc2; TSC4; Tuberin; tuberous sclerosis 2; tuberous sclerosis 2 homolog protein; tuberous sclerosis 2 protein; Tuberous sclerosis 2 protein homolog
• Common Name: TSC2
• Gene Symbol: TSC2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining