Invitrogen™ Human TSC22D1 (aa 628-712) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108113	100 μL

Catalog No. RP108113 Supplier Invitrogen™ Supplier No. RP108113

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67456. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSC22 domain family protein, or TSC22, is a transcription factor that belongs to the large family of early response genes. This transcriptional repressor is known to act on the C-type natriuretic peptide (CNP) promoter. TSC22 belongs to the TSC-22/Dip/Bun family and is an intracellular protein that may be found in the cytoplasm or nucleus. This transcription factor is known to regulate cell growth, differentiation and cell death and is involved in modulating the transcriptional activity of Smad3 and Smad4. This protein is ubiquitously expressed in most tissues and widely in both fetal and adult tissues. It is generally expressed in aortic endothelial cells, and induced by cytokines, including TGFB. These proteins may be possible therapeutic targets of leukemia and prostate cancer.

Specifications

• Accession Number: Q15714
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8848
• Name: Human TSC22D1 (aa 628-712) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA589566; AW105905; Cerebral protein 2; Egr5; hucep-2; Kiaa1994; Ptg-2; regulatory protein Tsc22; Regulatory protein TSC-22; RP11-269C23.2; short tandem repeat locus PEZ20 variant 19; Tgfb1i4; TGFbeta-stimulated clone 22; Tgfb-stimulated clone 22 homolog; Tilz1b; transcriptional regulator TSC-22; transforming growth factor beta 1 induced transcript 4; Transforming growth factor beta stimulated clone 22; transforming growth factor beta-1-induced transcript 4 protein; transforming growth factor beta-stimulated protein TSC-22; TS22A; Tsc; Tsc22; TSC-22; TSC22 domain family member 1; TSC22 domain family protein 1; TSC22 domain family, member 1; TSC22D1; Tsc22-related inducible leucine zipper 1b
• Common Name: TSC22D1
• Gene Symbol: Tsc22d1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining