Invitrogen™ Human TSC22D4 (aa 211-335) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89392	100 μL

Catalog No. RP89392 Supplier Invitrogen™ Supplier No. RP89392

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52342. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSC22D4 is a member of the TSC22 domain family of leucine zipper transcriptional regulators. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity. An important paralog of this gene is TSC22D1. Binds DNA and acts as a transcriptional repressor (PubMed:10488076). Involved in the regulation of systematic glucose homeostasis and insulin sensitivity, via transcriptional repression of downstream insulin signaling targets such as OBP2A/LCN13 (By similarity). Acts as a negative regulator of lipogenic gene expression in hepatocytes and thereby mediates the control of very low-density lipoprotein release (PubMed:23307490). May play a role in neurite elongation and survival (By similarity).

Specifications

• Accession Number: Q9Y3Q8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 81628
• Name: Human TSC22D4 (aa 211-335) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610009M14Rik; 1700023B23Rik; AI415410; LOW QUALITY PROTEIN: TSC22 domain family protein 4; THG1; THG-1; Thg1pit; Thg-1pit; Tilz2; TSC22 domain family 4; TSC22 domain family member 4; TSC22 domain family protein 4; TSC22 domain family, member 4; Tsc22d4; tsc-22-like protein THG-1; TSC22-related inducible leucine zipper 2; TSC22-related-inducible leucine zipper protein 2
• Common Name: TSC22D4
• Gene Symbol: Tsc22d4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining