Invitrogen™ Human TSCOT (aa 228-279) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92924	100 μL

Catalog No. RP92924 Supplier Invitrogen™ Supplier No. RP92924

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The TSCOT gene, known as the Thymic Stromal Co-transporter, plays a crucial role in the gene expression regulation within thymic epithelial cells, essential for T cell development. It encodes a protein that bears weak homology to bacterial 12 transmembrane co-transporters. Research indicates that TSCOT is predominantly expressed in thymic tissues, although low levels of expression are detectable in other epithelial tissues such as skin and lungs. The gene has been co-analyzed with Foxn1 and Hoxa3, highlighting its significant role in organogenesis. Studies utilizing competitive reverse transcription-polymerase chain reaction (RT-PCR) have mapped TSCOT to specific genomic regions, verifying its expression in a tissue and cell-type specific manner. The introduction of a neoantigen into TSCOT-expressing cells demonstrates its capability to mediate antigen-specific T cell tolerance, offering potential applications in immunological therapies.

Specifications

• Accession Number: Q9BY10
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57864
• Name: Human TSCOT (aa 228-279) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5430429N04Rik; Ly110; putative thymic stromal co-transporter TSCOT; SLC46A2; Solute carrier family 46 member 2; solute carrier family 46, member 2; thymic stromal co-transporter; thymic stromal cotransporter homolog; Thymic stromal cotransporter protein; TSCOT; TSO-1C12
• Common Name: TSCOT
• Gene Symbol: SLC46A2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining