Invitrogen™ Human TSLP Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108928	100 μL

Catalog No. RP108928 Supplier Invitrogen™ Supplier No. RP108928

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSLP is a 159 amino acid four helix-bundle hemopoietic cytokine that signals through a heterodimeric receptor complex consisting of the human TSLP receptor and the IL-7R alpha-chain. It impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes, enhances the maturation of CD11c (+) dendritic cells, naive CD4 (+), and CD8 (+) T cells into proallergic effectors, and primes dendritic cells to produce large amounts of IL-12 after CD40 ligand stimulation. TSLP influences the regulation of the positive selection of regulatory T cells and maintenance of peripheral CD4 (+) T cell homeostasis. It induces allergic inflammation by directly activating mast cells and may be involved in the pathophysiology of inflammatory arthritis. It is expressed in heart, liver and prostate.

Specifications

• Accession Number: Q969D9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 85480
• Name: Human TSLP Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Thymic stroma-derived lymphopoietin; thymic stromal lymphopoietin; TSLP
• Common Name: TSLP
• Gene Symbol: TSLP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MKCLGQSKKEEVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining