Invitrogen™ Human TSPAN9 (aa 123-200) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90695	100 μL

Catalog No. RP90695 Supplier Invitrogen™ Supplier No. RP90695

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53110. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSPAN9 includes the tetraspan family protein members which are characterized by four predicted transmembrane domains, and are thought to be involved in physiological processes such as tissue differentiation, immunological responses, and sperm-egg fusion. TSPAN9 has recently been identified as a platelet tetraspanin and a component of tetraspanin microdomains that include the collagen receptor GPVI (glycoprotein VI) and integrin alpha6beta1 but not the von Willebrand receptor GPIbalpha or the integrins alphaIIbbeta3 or alpha2beta1, suggesting that TSPAN9 may act to regulate platelet function in concert with other tetraspanins and their associated proteins.

Specifications

• Accession Number: O75954
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10867
• Name: Human TSPAN9 (aa 123-200) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6720474K14Rik; 9430079M16Rik; AU018597; NET5; NET-5; new EST tetraspan 5; PP1057; RGD1304740; tetraspan NET-5; tetraspanin 9; tetraspanin-9; transmembrane 4 superfamily member tetraspan NET-5; Tspan9; tspan-9
• Common Name: TSPAN9
• Gene Symbol: TSPAN9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining