Invitrogen™ Human TTBK2 (aa 819-921) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91429	100 μL

Catalog No. RP91429 Supplier Invitrogen™ Supplier No. RP91429

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53728. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tau tubulin kinase (TTBK2) is a serine/threonine kinase whose substrates are thought to include the tau and tubulin proteins. Mutations in the TTBK2 gene cause spinocerebellar ataxia type 11 (SCA11), a neurodegenerative disease characterized by progressive ataxia and atrophy of the cerebellum and brainstem. Recent studies have shown that increased levels of TTBK2 expression in kidney carcinoma and melanoma cell lines increases resistance to the chemotherapeutic agent Sunitinib, and that reduction of TTBK2 though the use of siRNA sensitized these cell lines to the effects of Sunitib, suggesting that TTBK2 can be used as a resistance marker as well a potential target to overcome resistance.

Specifications

• Accession Number: Q6IQ55
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 146057
• Name: Human TTBK2 (aa 819-921) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2610507N02Rik; AI326283; B930008N24Rik; Bby; KIAA0847; mKIAA0847; Protein bartleby; SCA11; tau tubulin kinase 1; tau tubulin kinase 2; tau-tubulin kinase 2; Ttbk; Ttbk1; TTBK2; TTK
• Common Name: TTBK2
• Gene Symbol: TTBK2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TTEPLDVTKTQTFSVVPNQDKNNEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFLHQEGKREKITPRNGELFHCVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining