Invitrogen™ Human TYROBP (aa 63-113) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98856	100 μL

Catalog No. RP98856 Supplier Invitrogen™ Supplier No. RP98856

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83577. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DAP12 is a transmembrane adaptor protein that is non-covalently associated with several cell surface receptors on natural killer (NK), myeloid, and presumably neuronal cells. DAP12 contains an ITAM domain that preferentially recruits the protein tyrosine kinase Syk to initiate signal transduction. Deficiency of DAP12 results in reduced antigen presentation function by myeloid cells and defects in function of certain NK cell receptors in mice, as well as presenile dementia and bone cysts in humans.

Specifications

• Accession Number: O43914
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7305
• Name: Human TYROBP (aa 63-113) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DAP12; DNAX-activation protein 12; KARAP; KAR-associated protein; killer cell activating receptor associated protein; killer cell activating receptor-associated protein; killer-activating receptor-associated protein; Ly83; PLOSL; TYRO protein tyrosine kinase binding protein; TYRO protein tyrosine kinase-binding protein; Tyrobp
• Common Name: TYROBP
• Gene Symbol: TYROBP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining