Invitrogen™ Human TYW1B (aa 160-238) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103003	100 μL

Catalog No. RP103003 Supplier Invitrogen™ Supplier No. RP103003

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61415. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Wybutosine is a hypermodified guanosine found in phenylalanine tRNA. Wybutosine functions to stabilize codon-anticodon interactions during ribosome decoding and therefore supports the maintenance of the reading frame. In yeast, the homolog of this gene is essential for the synthesis of wybutosine. The human genome contains two closely related genes that putatively function in wybutosine synthesis. The open reading frame of this locus is disrupted in some individuals. Thus, this locus appears to be an evolving pseudogene, but may still be functional in some members of the population. [provided by RefSeq, Apr 2014].

Specifications

• Accession Number: Q6NUM6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 441250
• Name: Human TYW1B (aa 160-238) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: LINC00069; long intergenic non-protein coding RNA 69; MGC87315; NCRNA00069; radical S-adenosyl methionine and flavodoxin domain-containing protein 2; radical S-adenosyl methionine and flavodoxin domains 1; RSAFD2; S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase; S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1B; tRNA wybutosine-synthesizing protein 1 homolog B; tRNA-yW synthesizing protein 1 homolog B; tRNA-yW synthesizing protein 1 homolog B (non-protein coding); TYW1B
• Common Name: TYW1B
• Gene Symbol: TYW1B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining