Invitrogen™ Human UBA5 (aa 15-70) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP110150	100 μL

Catalog No. RP110150 Supplier Invitrogen™ Supplier No. RP110150

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the E1-like ubiquitin-activating enzyme family. This protein activates ubiquitin-fold modifier 1, a ubiquitin-like post-translational modifier protein, via the formation of a high-energy thioester bond. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. A pseudogene located on chromosome 1 has also been identified.

Specifications

• Accession Number: Q9GZZ9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 79876
• Name: Human UBA5 (aa 15-70) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5730525G14Rik; AW240750; cb972; FLJ23251; FLJ23251UBA5; THIFP1; UBA5; UBA5, ubiquitin-activating enzyme E1 homolog; ube1dc1; ubiquitin like modifier activating enzyme 5; ubiquitin-activating enzyme 5; Ubiquitin-activating enzyme E1 domain-containing protein 1; ubiquitin-activating enzyme E1-domain containing 1; ubiquitin-like modifier activating enzyme 5; ubiquitin-like modifier-activating enzyme 5; ubiquitin-like modifier-activating enzyme 5-like protein; UFM1-activating enzyme
• Common Name: UBA5
• Gene Symbol: UBA5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining