Invitrogen™ Human UBE2A (aa 109-149) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104933	100 μL

Catalog No. RP104933 Supplier Invitrogen™ Supplier No. RP104933

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Multiple alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

Specifications

• Accession Number: P49459
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7319
• Name: Human UBE2A (aa 109-149) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: E2 ubiquitin-conjugating enzyme A; hhr6a; HR6A; Mhr6a; mp:zf637-2-000771; MRXS30; MRXSN; RAD6 homolog A; Rad6a; si:bz46j2.4; UBC2; ube2a; ube2a.L; Ubiquitin carrier protein A; ubiquitin conjugating enzyme E2 A; ubiquitin conjugating enzyme E2 A L homeolog; ubiquitin conjugating enzyme E2 A L homeolog; ubiquitin conjugating enzyme E2A L homeolog; ubiquitin conjugating enzyme E2A; ubiquitin-conjugating enzyme E2 A; ubiquitin-conjugating enzyme E2A; ubiquitin-conjugating enzyme E2A (RAD6 homolog); ubiquitin-conjugating enzyme E2A, RAD6 homolog; ubiquitin-conjugating enzyme HR6A; ubiquitin-protein ligase A; wu:fa01h11; XELAEV_18038882mg
• Common Name: UBE2A
• Gene Symbol: UBE2A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining