Invitrogen™ Human UBE2C (aa 29-108) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103205	100 μL

Catalog No. RP103205 Supplier Invitrogen™ Supplier No. RP103205

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-83234, PA5-111407. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.

Specifications

• Accession Number: O00762
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 11065
• Name: Human UBE2C (aa 29-108) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: (E3-independent) E2 ubiquitin-conjugating enzyme C; 1110015A16Rik; cyclin-selective ubiquitin carrier protein; D2Ertd695e; dJ447F3.2; E2 ubiquitin-conjugating enzyme C; mitotic-specific ubiquitin-conjugating enzyme; RP3-447F3.1; ubcH10; UBE2C; Ubiquitin carrier protein C; ubiquitin conjugating enzyme E2 C; ubiquitin conjugating enzyme E2C; ubiquitin-conjugating enzyme E2 C; ubiquitin-conjugating enzyme E2C; ubiquitin-protein ligase C
• Common Name: UBE2C
• Gene Symbol: UBE2C
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining