Invitrogen™ Human UBE2L3 (aa 86-154) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103973	100 μL

Catalog No. RP103973 Supplier Invitrogen™ Supplier No. RP103973

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro.

Specifications

• Accession Number: P68036
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 7332
• Name: Human UBE2L3 (aa 86-154) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C79827; E2 ubiquitin-conjugating enzyme L3; E2-F1; L-UBC; UBCE7; UBCH7; UbcM4; Ube2l3; Ubiquitin carrier protein L3; ubiquitin conjugating enzyme E2 L3; ubiquitin conjugating enzyme E2L 3; ubiquitin-conjugating enzyme 7; ubiquitin-conjugating enzyme E2 L3; Ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme E2L 3; ubiquitin-conjugating enzyme UBCH7; ubiquitin-protein ligase L3; Unknown (protein for MGC:127956)
• Common Name: UBE2L3
• Gene Symbol: UBE2L3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining