Invitrogen™ Human UBE4A (aa 36-171) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102399	100 μL

Catalog No. RP102399 Supplier Invitrogen™ Supplier No. RP102399

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitination requires a ubiquitin-activating enzyme, a ubiquitin-conjugating enzyme, and usually a substrate-specific ubiquitin-protein ligase. Multiubiquitination needs a fourth factor, to bind to the ubiquitin moieties of preformed conjugates and catalyze ubiquitin chain assembly in conjunction with the first three proteins. Human protein KIAA0126, with a predicted 1,073 amino acid residues, is a member of the novel protein family defined by ubiquitination conjugation factor E4. In yeast, E4 activity is linked to cell survival under stress conditions, indicating that eucaryotes use E4-dependent proteolysis pathways for multiple cellular functions.

Specifications

• Accession Number: Q14139
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9354
• Name: Human UBE4A (aa 36-171) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4732444G18Rik; 9930123J21Rik; Ab2-232; E4; KIAA0126; RING-type E3 ubiquitin transferase E4 A; UBE4A; Ubiquitin conjugation factor E4 A; ubiquitination factor E4A; ubiquitination factor E4A (UFD2 homolog, yeast); ubiquitination factor E4A, UFD2 homolog; UBOX2; UFD2; UFD2b
• Common Name: UBE4A
• Gene Symbol: Ube4a
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSDPSLKSGNGIPSRCVYLEEMAVELEDQDWLDMSNVEQALFARLLLQDPGNHLINMTSSTTLNLSADRDAGER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining