Invitrogen™ Human UNC5CL (aa 368-517) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90179	100 μL

Catalog No. RP90179 Supplier Invitrogen™ Supplier No. RP90179

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UNC5CL is a membrane protein belonging to theUNC-5 family with a death domain and a ZU5 domain and is known to interact with p65/RELA and NFKB1. UNC5CL is known to interact with subunit p105 of NF-kappaB and transactivator p65 and is thus involved in inhibition of NF-kappaB activation and NF-kappaB-dependent transcription by inhibiting the binding of NF-kappaB to its target sequence (providing an alternative regulatory mechanism for NF-kappaB-mediated transcription). This regulatory protein sensitizes cells to apoptosis induced by TNF and TRAIL.

Specifications

• Accession Number: Q8IV45
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 222643
• Name: Human UNC5CL (aa 368-517) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2510009H09Rik; BB155270; MGC34763; MUXA; OTTHUMP00000016362; protein unc-5 homolog C-like; unc-5 family C-terminal like; unc-5 homolog C (C. elegans)-like; UNC5CL; UNC5C-like protein; zu-5; ZU5 and death domain containing; ZU5 and death domain-containing inhibitor of NF-kB; ZU5 and death domain-containing protein; ZUD
• Common Name: UNC5CL
• Gene Symbol: UNC5CL
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MHTFQDGLETKYMEILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLLEPNSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAILELFEEQNGSLQELHYLMTVMERLDCASAIQNYLSGTHGGSPGPERGGARDNQGLELDEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining